PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_A12G0867
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 289aa    MW: 32305.5 Da    PI: 8.5884
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_A12G0867genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.27.6e-41168245178
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                  +Cq+egC+adl++ak+yhrrhkvCe+hska++v+++gl+qrfCqqCsrfh lsefD++krsCr+rLa+hn+rrrk+q+
  Gh_A12G0867 168 RCQAEGCNADLTHAKHYHRRHKVCEFHSKASTVIATGLTQRFCQQCSRFHLLSEFDNGKRSCRKRLADHNRRRRKSQH 245
                  6**************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.3E-35162230IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.334166243IPR004333Transcription factor, SBP-box
SuperFamilySSF1036125.76E-38167246IPR004333Transcription factor, SBP-box
PfamPF031108.3E-31169242IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MLEYEWGNPT AMILTGEEAD QEPDPTRQIL EHYGANTATH HHHQAGFNET LFPHQQSAAF  60
VPFQAQTQHG YLHSMYDPRA YTGASAYTTP HPSSLLSLDP VSGTGGNGGG GYFLVPKTEE  120
VSRPVDFTAR IGLNLGGRTY FSSAEDDFVN RLYRRSRPGE PGSTNSPRCQ AEGCNADLTH  180
AKHYHRRHKV CEFHSKASTV IATGLTQRFC QQCSRFHLLS EFDNGKRSCR KRLADHNRRR  240
RKSQHQQQQP SNQENQLKHS TLENGRNSTT DNNHPSKVTT ATTAATVGF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A1e-32159242184squamosa promoter binding protein-like 4
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Ghi.199280.0boll| ovule
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012437525.10.0PREDICTED: squamosa promoter-binding-like protein 8
SwissprotQ8GXL36e-88SPL8_ARATH; Squamosa promoter-binding-like protein 8
TrEMBLA0A0D2PSM50.0A0A0D2PSM5_G
STRINGVIT_15s0021g02300.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70102743
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G02065.15e-84squamosa promoter binding protein-like 8